Lineage for d6jp7l2 (6jp7 L:113-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750473Domain d6jp7l2: 6jp7 L:113-217 [379795]
    Other proteins in same PDB: d6jp7h1, d6jp7h2, d6jp7h3, d6jp7l1
    automated match to d1jvka2
    complexed with 3fx, p6g

Details for d6jp7l2

PDB Entry: 6jp7 (more details), 1.91 Å

PDB Description: human antibody 32d6 fab in complex with peg
PDB Compounds: (L:) Immunoglobulin Fab light chain

SCOPe Domain Sequences for d6jp7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jp7l2 b.1.1.2 (L:113-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qskaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d6jp7l2:

Click to download the PDB-style file with coordinates for d6jp7l2.
(The format of our PDB-style files is described here.)

Timeline for d6jp7l2: