![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
![]() | Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
![]() | Protein automated matches [190988] (22 species) not a true protein |
![]() | Species Coxsackievirus a16 [TaxId:31704] [276271] (7 PDB entries) |
![]() | Domain d6lhqa_: 6lhq A: [379793] Other proteins in same PDB: d6lhqc_, d6lhqh_, d6lhql_ automated match to d5c8ca_ complexed with sph |
PDB Entry: 6lhq (more details), 3.06 Å
SCOPe Domain Sequences for d6lhqa_:
Sequence, based on SEQRES records: (download)
>d6lhqa_ b.121.4.0 (A:) automated matches {Coxsackievirus a16 [TaxId: 31704]} dpiadmidqtvnnqvnrsltalqvlptaanteasshrlgtgvvpalqaaetgassnasdk nlietrcvlnhhstqetaignffsraglvsiitmpttdtqntdgyvnwdidlmgyaqlrr kcelftymrfdaeftfvvakpngvlvpqllqymyvppgapkptsrdsfawqtatnpsvfv kmtdppaqvsvpfmspasayqwfydgyptfgehlqandldygqcpnnmmgtfsirtvgte ksphsitlrvymrikhvrawiprplrnqpylfktnpnykgndikctstsrdkittl
>d6lhqa_ b.121.4.0 (A:) automated matches {Coxsackievirus a16 [TaxId: 31704]} dpiadmidrsltalqvlptaanteasshrlgtgvvpalqaaetgassnasdknlietrcv lnhhstqetaignffsraglvsiitmpntdgyvnwdidlmgyaqlrrkcelftymrfdae ftfvvakpngvlvpqllqymyvppgapkptsrdsfawqtatnpsvfvkmtdppaqvsvpf mspasayqwfydgyptfgehlqandldygqcpnnmmgtfsirtvgteksphsitlrvymr ikhvrawiprplrnqpylfktnpnykgndikctstsrdkittl
Timeline for d6lhqa_:
![]() Domains from other chains: (mouse over for more information) d6lhqb_, d6lhqc_, d6lhqh_, d6lhql_ |