Lineage for d6lhoc_ (6lho C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431063Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2431354Protein automated matches [190854] (25 species)
    not a true protein
  7. 2431366Species Coxsackievirus a16 [TaxId:31704] [276274] (7 PDB entries)
  8. 2431373Domain d6lhoc_: 6lho C: [379792]
    Other proteins in same PDB: d6lhob_
    automated match to d5c8cc_

Details for d6lhoc_

PDB Entry: 6lho (more details), 3.13 Å

PDB Description: the cryo-em structure of coxsackievirus a16 empty particle in complex with fab 18a7
PDB Compounds: (C:) vp3 protein

SCOPe Domain Sequences for d6lhoc_:

Sequence, based on SEQRES records: (download)

>d6lhoc_ b.121.4.1 (C:) automated matches {Coxsackievirus a16 [TaxId: 31704]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah
aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdt

Sequence, based on observed residues (ATOM records): (download)

>d6lhoc_ b.121.4.1 (C:) automated matches {Coxsackievirus a16 [TaxId: 31704]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisntyttgi
itiwyqtnyvvpigapttayivalaaaqdnftmklckdt

SCOPe Domain Coordinates for d6lhoc_:

Click to download the PDB-style file with coordinates for d6lhoc_.
(The format of our PDB-style files is described here.)

Timeline for d6lhoc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6lhob_