![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (29 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
![]() | Domain d6lhqh_: 6lhq H: [379789] Other proteins in same PDB: d6lhqa_, d6lhqb_, d6lhqc_, d6lhql_ automated match to d5i0za_ complexed with sph |
PDB Entry: 6lhq (more details), 3.06 Å
SCOPe Domain Sequences for d6lhqh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lhqh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} evqlqqsgpelvkpgasvkmsckasgytftdyymkwvkqshgkslewigdinpnngatsy nqkfkgkatltvdkssstaymqlnsltsedsavyycarrgyglyyamdywgqgtsvtvss
Timeline for d6lhqh_:
![]() Domains from other chains: (mouse over for more information) d6lhqa_, d6lhqb_, d6lhqc_, d6lhql_ |