Lineage for d6lhqh_ (6lhq H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2371371Domain d6lhqh_: 6lhq H: [379789]
    Other proteins in same PDB: d6lhqa_, d6lhqb_, d6lhqc_, d6lhql_
    automated match to d5i0za_
    complexed with sph

Details for d6lhqh_

PDB Entry: 6lhq (more details), 3.06 Å

PDB Description: the cryo-em structure of coxsackievirus a16 mature virion in complex with fab na9d7
PDB Compounds: (H:) heavy chain variable region of Fab NA9D7

SCOPe Domain Sequences for d6lhqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lhqh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgasvkmsckasgytftdyymkwvkqshgkslewigdinpnngatsy
nqkfkgkatltvdkssstaymqlnsltsedsavyycarrgyglyyamdywgqgtsvtvss

SCOPe Domain Coordinates for d6lhqh_:

Click to download the PDB-style file with coordinates for d6lhqh_.
(The format of our PDB-style files is described here.)

Timeline for d6lhqh_: