SCOPe 2.08: Domain d6lh6b_: 6lh6 B:

Lineage for d6lh6b_ (6lh6 B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families)

5. Family g.3.13.0: automated matches [254212] (1 protein)
   not a true family

6. Protein automated matches [254478] (3 species)
   not a true protein

7. Species Cicer arietinum [TaxId:3827] [379777] (1 PDB entry)

8. Domain d6lh6b_: 6lh6 B: [379778]
   automated match to d2aiha_

Details for d6lh6b_

PDB Entry: 6lh6, 1.4 Å

PDB Description: crystal structure of a double headed bowman-birk protease inhibitor protein from chickpea.

PDB Compounds: (B:) Bowman-Birk type proteinase inhibitor-like

SCOPe Domain Sequences for d6lh6b_:

Sequence; same for both SEQRES and ATOM records:

>d6lh6b_ g.3.13.0 (B:) automated matches {Cicer arietinum [TaxId: 3827]}
gykvkstttaccdscvctksippqcrcndmgetchsackqcicalsyppicrcmdntgfc
ydscsk

Timeline for d6lh6b_:

• d6lh6b_ first appeared in SCOPe 2.07