SCOPe 2.08: Domain d6jcia2: 6jci A:430-706

Lineage for d6jcia2 (6jci A:430-706)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (2 proteins)
   N-terminal domain is a 7-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein Prolyl oligopeptidase, C-terminal domain [53497] (2 species)

7. Species Haliotis discus [TaxId:42344] [379764] (2 PDB entries)

8. Domain d6jcia2: 6jci A:430-706 [379765]
   Other proteins in same PDB: d6jcia1
   automated match to d1e8na2
   complexed with bko, gol

Details for d6jcia2

PDB Entry: 6jci, 1.49 Å

PDB Description: crystal structure of prolyl endopeptidase from haliotis discus hannai with suam-14746

PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d6jcia2:

Sequence; same for both SEQRES and ATOM records:

>d6jcia2 c.69.1.4 (A:430-706) Prolyl oligopeptidase, C-terminal domain {Haliotis discus [TaxId: 42344]}
dtsqfeteqvffpskdgtkipmfivhrkglvhdgshpvmlygyggfnisitpsfspsrlv
flqhlggvyaianirgggeygeswhkagncankqnvfddfqsaaqylienkwtsakriti
nggsnggllvgacinqrpdlfgcavaqvgvldmlrfhkftighawttdygssdstddfkv
likysplhnireqkdqypalllltgdhddrvvplhslkflaqiqytfkdsdsqtnplmgr
idtksghgfgkptakvieeltdiysfmhqtvglkwsd

Timeline for d6jcia2:

• d6jcia2 first appeared in SCOPe 2.07