Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) |
Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 proteins) automatically mapped to Pfam PF02897 |
Protein Prolyl oligopeptidase, N-terminal domain [50995] (3 species) |
Species Haliotis discus [TaxId:42344] [379761] (2 PDB entries) |
Domain d6jcia1: 6jci A:3-429 [379763] Other proteins in same PDB: d6jcia2 automated match to d2xdwa1 complexed with bko, gol |
PDB Entry: 6jci (more details), 1.49 Å
SCOPe Domain Sequences for d6jcia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jcia1 b.69.7.1 (A:3-429) Prolyl oligopeptidase, N-terminal domain {Haliotis discus [TaxId: 42344]} kftypnarrdelvedyhgtkvteyyrwledpdseetkafveaqnelskpfldacpirekl ssritevwdypkyscpgrhgeyfyyyhntglqnqsvlyaqkglgadpsvfldpnslsedg tvslrgtafsendqffayglsksgsdwvtikfkkapsgedlpdtlervkfssmawthdhk glfynryleqqgksdgtettmnvdqklfyhrlgtdqsedvlvaefpehprwmigaevsdc grylvmtihegcdpvnrlyyvdlksmqneirgvlsyvkivdnfdaeyeyitndgskftfk tnlnasryklinidfadpdqsnwqtlvdedeksvlewaacvnkdklilcylkdvknelyv hglssgsrmsqlplevgsvvgysgkkkydeifyqftsfltpgiiyrcdmttdtytpktfr eikvkdf
Timeline for d6jcia1: