| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) ![]() |
| Family d.16.1.5: L-amino acid/polyamine oxidase [54394] (2 proteins) |
| Protein L-amino acid oxidase [54397] (1 species) |
| Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [54398] (2 PDB entries) |
| Domain d1f8rc2: 1f8r C:320-432 [37976] Other proteins in same PDB: d1f8ra1, d1f8rb1, d1f8rc1, d1f8rd1 |
PDB Entry: 1f8r (more details), 2 Å
SCOP Domain Sequences for d1f8rc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f8rc2 d.16.1.5 (C:320-432) L-amino acid oxidase {Malayan pit viper (Calloselasma rhodostoma)}
hyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftngvgviiaygigddan
ffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldkyamggitt
Timeline for d1f8rc2: