Lineage for d1f8rc2 (1f8r C:320-432)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78269Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 78270Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 78381Family d.16.1.5: L-amino acid/polyamine oxidase [54394] (2 proteins)
  6. 78382Protein L-amino acid oxidase [54397] (1 species)
  7. 78383Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [54398] (2 PDB entries)
  8. 78386Domain d1f8rc2: 1f8r C:320-432 [37976]
    Other proteins in same PDB: d1f8ra1, d1f8rb1, d1f8rc1, d1f8rd1

Details for d1f8rc2

PDB Entry: 1f8r (more details), 2 Å

PDB Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma complexed with citrate

SCOP Domain Sequences for d1f8rc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8rc2 d.16.1.5 (C:320-432) L-amino acid oxidase {Malayan pit viper (Calloselasma rhodostoma)}
hyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftngvgviiaygigddan
ffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldkyamggitt

SCOP Domain Coordinates for d1f8rc2:

Click to download the PDB-style file with coordinates for d1f8rc2.
(The format of our PDB-style files is described here.)

Timeline for d1f8rc2: