Lineage for d6jd8a1 (6jd8 A:1-316)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926957Protein automated matches [190264] (12 species)
    not a true protein
  7. 2926979Species Human (Homo sapiens) [TaxId:9606] [187102] (9 PDB entries)
  8. 2926980Domain d6jd8a1: 6jd8 A:1-316 [379750]
    Other proteins in same PDB: d6jd8a2
    automated match to d1cs8a_
    complexed with edo, eoh, gol, peg, pge; mutant

Details for d6jd8a1

PDB Entry: 6jd8 (more details), 1.46 Å

PDB Description: structure of a proline specific mutant of human cathepsin l
PDB Compounds: (A:) Cathepsin L1

SCOPe Domain Sequences for d6jd8a1:

Sequence, based on SEQRES records: (download)

>d6jd8a1 d.3.1.1 (A:1-316) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tltfdhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmam
nafgdmtseefrqvmngfqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgs
swafsatgalegqmfrktgrlislseqnlvdcsgpqgnegcnggymdyafqyvqdnggld
seesypyeateesckynpkysvandtgfvdipkqekalmkavatvgpisvaidaghesfl
fykegiyfepdcssedldhavlvvgygfestesdnnkywlvknswgeewgmggyvkmakd
rrnhcgiaslasyptv

Sequence, based on observed residues (ATOM records): (download)

>d6jd8a1 d.3.1.1 (A:1-316) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tltfdhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmam
nafgdmtseefrqvmngfqkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgssw
afsatgalegqmfrktgrlislseqnlvdcsgpqgnegcnggymdyafqyvqdnggldse
esypyeateesckynpkysvandtgfvdipkqekalmkavatvgpisvaidaghesflfy
kegiyfepdcssedldhavlvvgygfestednnkywlvknswgeewgmggyvkmakdrrn
hcgiaslasyptv

SCOPe Domain Coordinates for d6jd8a1:

Click to download the PDB-style file with coordinates for d6jd8a1.
(The format of our PDB-style files is described here.)

Timeline for d6jd8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6jd8a2