Lineage for d6vigb_ (6vig B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728396Protein Estrogen receptor alpha [48519] (1 species)
  7. 2728397Species Human (Homo sapiens) [TaxId:9606] [48520] (107 PDB entries)
    Uniprot P03372 307-551
  8. 2728404Domain d6vigb_: 6vig B: [379737]
    automated match to d3erta_
    complexed with mg, qym

Details for d6vigb_

PDB Entry: 6vig (more details), 1.45 Å

PDB Description: estrogen receptor alpha ligand binding domain in complex with ru39411
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d6vigb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vigb_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld

SCOPe Domain Coordinates for d6vigb_:

Click to download the PDB-style file with coordinates for d6vigb_.
(The format of our PDB-style files is described here.)

Timeline for d6vigb_: