Lineage for d1h81c2 (1h81 C:294-405)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30799Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 30800Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 30911Family d.16.1.5: L-amino acid/polyamine oxidase [54394] (2 proteins)
  6. 30926Protein Polyamine oxidase [54395] (1 species)
  7. 30927Species Maize (Zea mays) [TaxId:4577] [54396] (7 PDB entries)
  8. Domain d1h81c2: 1h81 C:294-405 [37973]
    Other proteins in same PDB: d1h81a1, d1h81b1, d1h81c1

Details for d1h81c2

PDB Entry: 1h81 (more details), 2.1 Å

PDB Description: structure of polyamine oxidase in the reduced state

SCOP Domain Sequences for d1h81c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h81c2 d.16.1.5 (C:294-405) Polyamine oxidase {Maize (Zea mays)}
dmavytkiflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdee
srrieqqsdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsn

SCOP Domain Coordinates for d1h81c2 are not available.

Timeline for d1h81c2:

Domains from same chain:
(mouse over for more information)
d1h81c1
Domains from other chains:
(mouse over for more information)
d1h81a1, d1h81a2, d1h81b1, d1h81b2