Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (42 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [255553] (4 PDB entries) |
Domain d6vfye1: 6vfy E:58-206 [379729] automated match to d2qq2i_ complexed with coa, po4 |
PDB Entry: 6vfy (more details), 2.6 Å
SCOPe Domain Sequences for d6vfye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vfye1 d.38.1.0 (E:58-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqicrimrpddanvagnvhggtilkmieeagaiistrhcnsqngercvaalarvertdfl spmcigevahvsaeitytskhsvevqvhvmseniltgtkkltnkatlwyvplslknvdkv levppivylrqeqeeegrkryeaqklerm
Timeline for d6vfye1:
View in 3D Domains from other chains: (mouse over for more information) d6vfyd1, d6vfyd2, d6vfyf1, d6vfyf2 |