SCOPe 2.08: Domain d6vdia1: 6vdi A:6-155

Lineage for d6vdia1 (6vdi A:6-155)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Apicomplexa sp. [TaxId:2041159] [379703] (3 PDB entries)

8. Domain d6vdia1: 6vdi A:6-155 [379722]
   Other proteins in same PDB: d6vdia2, d6vdib2
   automated match to d2ewda3
   complexed with so4

Details for d6vdia1

PDB Entry: 6vdi, 2.1 Å

PDB Description: crystal structure of ancestral apicomplexan lactate dehydrogenase with sulfate.

PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d6vdia1:

Sequence, based on SEQRES records:

>d6vdia1 c.2.1.0 (A:6-155) automated matches {Apicomplexa sp. [TaxId: 2041159]}
nkrpkisligsgmiggtmaylcalkelgdvvlfdvvknmpqgkaldlshstsvadtnvkv
tgtnsyedikgsdvviitagltkvpgksdkewsrddllpinakimkevgenikkycpnaf
vicitnpldvmvkvlqeasglphnkvcgma

Sequence, based on observed residues (ATOM records):

>d6vdia1 c.2.1.0 (A:6-155) automated matches {Apicomplexa sp. [TaxId: 2041159]}
nkrpkisligsgmiggtmaylcalkelgdvvlfdvvknmpqgkaldlshstsvadtnvkv
tgtnsyedikgsdvviitagltdllpinakimkevgenikkycpnafvicitnpldvmvk
vlqeasglphnkvcgma

Timeline for d6vdia1:

• d6vdia1 first appeared in SCOPe 2.07