Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Apicomplexa sp. [TaxId:2041159] [379703] (3 PDB entries) |
Domain d6vdjb1: 6vdj B:7-155 [379704] Other proteins in same PDB: d6vdja2, d6vdjb2 automated match to d2ewda3 complexed with so4, txd |
PDB Entry: 6vdj (more details), 2 Å
SCOPe Domain Sequences for d6vdjb1:
Sequence, based on SEQRES records: (download)
>d6vdjb1 c.2.1.0 (B:7-155) automated matches {Apicomplexa sp. [TaxId: 2041159]} krpkisligsgmiggtmaylcalkelgdvvlfdvvknmpqgkaldlshstsvadtnvkvt gtnsyedikgsdvviitagltkvpgksdkewsrddllpinakimkevgenikkycpnafv icitnpldvmvkvlqeasglphnkvcgma
>d6vdjb1 c.2.1.0 (B:7-155) automated matches {Apicomplexa sp. [TaxId: 2041159]} krpkisligsgmiggtmaylcalkelgdvvlfdvvknmpqgkaldlshstsvadtnvkvt gtnsyedikgsdvviitagltkvpgdkewsrddllpinakimkevgenikkycpnafvic itnpldvmvkvlqeasglphnkvcgma
Timeline for d6vdjb1: