Lineage for d1b5qb2 (1b5q B:294-405)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 854919Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 854920Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 855121Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 855231Protein Polyamine oxidase [54395] (1 species)
  7. 855232Species Maize (Zea mays) [TaxId:4577] [54396] (7 PDB entries)
  8. 855234Domain d1b5qb2: 1b5q B:294-405 [37969]
    Other proteins in same PDB: d1b5qa1, d1b5qb1, d1b5qc1

Details for d1b5qb2

PDB Entry: 1b5q (more details), 1.9 Å

PDB Description: a 30 angstrom u-shaped catalytic tunnel in the crystal structure of polyamine oxidase
PDB Compounds: (B:) protein (polyamine oxidase)

SCOP Domain Sequences for d1b5qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b5qb2 d.16.1.5 (B:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}
dmavytkiflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdee
srrieqqsdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsn

SCOP Domain Coordinates for d1b5qb2:

Click to download the PDB-style file with coordinates for d1b5qb2.
(The format of our PDB-style files is described here.)

Timeline for d1b5qb2: