| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
| Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
| Protein Polyamine oxidase [54395] (1 species) |
| Species Maize (Zea mays) [TaxId:4577] [54396] (7 PDB entries) |
| Domain d1h84b2: 1h84 B:294-405 [37966] Other proteins in same PDB: d1h84a1, d1h84b1, d1h84c1 complexed with fad, nba |
PDB Entry: 1h84 (more details), 2 Å
SCOPe Domain Sequences for d1h84b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h84b2 d.16.1.5 (B:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}
dmavytkiflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdee
srrieqqsdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsn
Timeline for d1h84b2:
View in 3DDomains from other chains: (mouse over for more information) d1h84a1, d1h84a2, d1h84c1, d1h84c2 |