Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (26 species) |
Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries) |
Domain d6r2ob_: 6r2o B: [379658] Other proteins in same PDB: d6r2oa_, d6r2oc_ automated match to d1s0hb1 complexed with cl, hem, na, peg |
PDB Entry: 6r2o (more details), 2.46 Å
SCOPe Domain Sequences for d6r2ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6r2ob_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]} vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk dftpelqasyqkvvagvanalahky
Timeline for d6r2ob_: