SCOPe 2.08: Domain d6sqwa_: 6sqw A:

Lineage for d6sqwa_ (6sqw A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.2: MazG-like [116993] (4 proteins)
   Pfam PF03819

6. Protein automated matches [315024] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [379652] (3 PDB entries)

8. Domain d6sqwa_: 6sqw A: [379657]
   automated match to d2a3qa1
   complexed with 5cm, mg

Details for d6sqwa_

PDB Entry: 6sqw, 1.8 Å

PDB Description: mouse dctpase in complex with 5-me-dcmp

PDB Compounds: (A:) dCTP pyrophosphatase 1

SCOPe Domain Sequences for d6sqwa_:

Sequence; same for both SEQRES and ATOM records:

>d6sqwa_ a.204.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepg
pqawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtnrqrypvhls

Timeline for d6sqwa_:

• d6sqwa_ first appeared in SCOPe 2.07