Lineage for d5qtya_ (5qty A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (33 species)
    not a true protein
  7. 2390333Species Human (Homo sapiens) [TaxId:9606] [187421] (92 PDB entries)
  8. 3079583Domain d5qtya_: 5qty A: [379645]
    automated match to d1p57b_
    complexed with edo, qlj, so4

Details for d5qtya_

PDB Entry: 5qty (more details), 1.89 Å

PDB Description: factor xia in complex with the inhibitor ethyl (2r,7s)-7-({(2e)-3-[5- chloro-2-(1h-tetrazol-1-yl)phenyl]prop-2-enoyl}amino)-15- [(methoxycarbonyl)amino]-2,3,4,5,6,7-hexahydro-1h-12,8-(metheno)-1,9- benzodiazacyclotetradecine-2-carboxylate
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d5qtya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qtya_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d5qtya_:

Click to download the PDB-style file with coordinates for d5qtya_.
(The format of our PDB-style files is described here.)

Timeline for d5qtya_:

  • d5qtya_ is new in SCOPe 2.07-stable