Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (3 proteins) |
Protein Polyamine oxidase [54395] (1 species) |
Species Maize (Zea mays) [TaxId:4577] [54396] (7 PDB entries) |
Domain d1h86c2: 1h86 C:294-405 [37964] Other proteins in same PDB: d1h86a1, d1h86b1, d1h86c1 complexed with fad, fca, man, nag, nba |
PDB Entry: 1h86 (more details), 2 Å
SCOP Domain Sequences for d1h86c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h86c2 d.16.1.5 (C:294-405) Polyamine oxidase {Maize (Zea mays)} dmavytkiflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdee srrieqqsdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsn
Timeline for d1h86c2:
View in 3D Domains from other chains: (mouse over for more information) d1h86a1, d1h86a2, d1h86b1, d1h86b2 |