Lineage for d1h86c2 (1h86 C:294-405)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935459Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 2935624Protein Polyamine oxidase [54395] (1 species)
  7. 2935625Species Maize (Zea mays) [TaxId:4577] [54396] (7 PDB entries)
  8. 2935640Domain d1h86c2: 1h86 C:294-405 [37964]
    Other proteins in same PDB: d1h86a1, d1h86b1, d1h86c1
    complexed with fad, nag, nba

Details for d1h86c2

PDB Entry: 1h86 (more details), 2 Å

PDB Description: covalent adduct between polyamine oxidase and n1ethyln11((cycloheptyl)methyl)4,8diazaundecane at ph 7.0
PDB Compounds: (C:) polyamine oxidase

SCOPe Domain Sequences for d1h86c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h86c2 d.16.1.5 (C:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}
dmavytkiflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdee
srrieqqsdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsn

SCOPe Domain Coordinates for d1h86c2:

Click to download the PDB-style file with coordinates for d1h86c2.
(The format of our PDB-style files is described here.)

Timeline for d1h86c2: