Lineage for d6r2oa_ (6r2o A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686340Species Horse (Equus caballus) [TaxId:9796] [46488] (19 PDB entries)
  8. 2686357Domain d6r2oa_: 6r2o A: [379627]
    Other proteins in same PDB: d6r2ob_, d6r2od_
    automated match to d1iwha_
    complexed with cl, hem, na, peg

Details for d6r2oa_

PDB Entry: 6r2o (more details), 2.46 Å

PDB Description: hemoglobin structure from serial crystallography with a 3d-printed nozzle.
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d6r2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r2oa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d6r2oa_:

Click to download the PDB-style file with coordinates for d6r2oa_.
(The format of our PDB-style files is described here.)

Timeline for d6r2oa_: