Lineage for d1h83c2 (1h83 C:294-405)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895243Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1895244Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1895454Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 1895601Protein Polyamine oxidase [54395] (1 species)
  7. 1895602Species Maize (Zea mays) [TaxId:4577] [54396] (7 PDB entries)
  8. 1895611Domain d1h83c2: 1h83 C:294-405 [37961]
    Other proteins in same PDB: d1h83a1, d1h83b1, d1h83c1
    complexed with dia, fad, nag

Details for d1h83c2

PDB Entry: 1h83 (more details), 1.9 Å

PDB Description: structure of polyamine oxidase in complex with 1,8-diaminooctane
PDB Compounds: (C:) polyamine oxidase

SCOPe Domain Sequences for d1h83c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h83c2 d.16.1.5 (C:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}
dmavytkiflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdee
srrieqqsdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsn

SCOPe Domain Coordinates for d1h83c2:

Click to download the PDB-style file with coordinates for d1h83c2.
(The format of our PDB-style files is described here.)

Timeline for d1h83c2: