Lineage for d6px9d_ (6px9 D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2437680Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2437681Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2437682Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)
  6. 2437759Protein Caspase-8 [52135] (1 species)
  7. 2437760Species Human (Homo sapiens) [TaxId:9606] [52136] (8 PDB entries)
  8. 3079545Domain d6px9d_: 6px9 D: [379607]
    automated match to d3h11b_
    complexed with 63r

Details for d6px9d_

PDB Entry: 6px9 (more details), 2.88 Å

PDB Description: crystal structure of procaspase-8 in complex with covalent small molecule inhibitor 63-r
PDB Compounds: (D:) caspase-8

SCOPe Domain Sequences for d6px9d_:

Sequence, based on SEQRES records: (download)

>d6px9d_ c.17.1.1 (D:) Caspase-8 {Human (Homo sapiens) [TaxId: 9606]}
ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
kphddctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
glkcpslagkpkvffiqacqgdnyqkgipvetaseeqpylemalsspqtryipdeadfll
gmatvnnsvsyrnpaegtwyiqslcqslrersprgddiltiltevnyevsnkddkknmgk
qmpqptftlrkklvfpsd

Sequence, based on observed residues (ATOM records): (download)

>d6px9d_ c.17.1.1 (D:) Caspase-8 {Human (Homo sapiens) [TaxId: 9606]}
ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
kphddctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
glkcpslagkpkvffiqacqqtryipdeadfllgmatvnwyiqslcqslrersprgddil
tiltevnyevsnqmpqptftlrkklvfpsd

SCOPe Domain Coordinates for d6px9d_:

Click to download the PDB-style file with coordinates for d6px9d_.
(The format of our PDB-style files is described here.)

Timeline for d6px9d_:

  • d6px9d_ is new in SCOPe 2.07-stable