Lineage for d6qdua1 (6qdu A:1-231)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333696Species Human (Homo sapiens) [TaxId:9606] [187008] (49 PDB entries)
  8. 3079533Domain d6qdua1: 6qdu A:1-231 [379595]
    Other proteins in same PDB: d6qdua2
    automated match to d2o98a_
    complexed with cl, hy5, na, tpo

Details for d6qdua1

PDB Entry: 6qdu (more details), 1.63 Å

PDB Description: crystal structure of 14-3-3sigma in complex with a rapgef2 pt740 phosphopeptide inhibited by semi-synthetic fusicoccane fc-ncpc
PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d6qdua1:

Sequence, based on SEQRES records: (download)

>d6qdua1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records): (download)

>d6qdua1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneeekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkm
kgdyyrylaevatdkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeian
speeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d6qdua1:

Click to download the PDB-style file with coordinates for d6qdua1.
(The format of our PDB-style files is described here.)

Timeline for d6qdua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6qdua2