Lineage for d1h82c2 (1h82 C:294-405)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78269Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 78270Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 78381Family d.16.1.5: L-amino acid/polyamine oxidase [54394] (2 proteins)
  6. 78396Protein Polyamine oxidase [54395] (1 species)
  7. 78397Species Maize (Zea mays) [TaxId:4577] [54396] (7 PDB entries)
  8. 78403Domain d1h82c2: 1h82 C:294-405 [37958]
    Other proteins in same PDB: d1h82a1, d1h82b1, d1h82c1

Details for d1h82c2

PDB Entry: 1h82 (more details), 1.9 Å

PDB Description: structure of polyamine oxidase in complex with guazatine

SCOP Domain Sequences for d1h82c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h82c2 d.16.1.5 (C:294-405) Polyamine oxidase {Maize (Zea mays)}
dmavytkiflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdee
srrieqqsdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsn

SCOP Domain Coordinates for d1h82c2:

Click to download the PDB-style file with coordinates for d1h82c2.
(The format of our PDB-style files is described here.)

Timeline for d1h82c2: