SCOPe 2.07: Domain d6p01a1: 6p01 A:2-125

Lineage for d6p01a1 (6p01 A:2-125)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins)
   insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243

6. Protein automated matches [378998] (3 species)
   not a true protein

7. Species Bacillus sp. [TaxId:1409] [379550] (4 PDB entries)

8. Domain d6p01a1: 6p01 A:2-125 [379575]
   Other proteins in same PDB: d6p01a2, d6p01b2
   automated match to d1knya2
   protein/DNA complex; complexed with cl, gol, mg; mutant

Details for d6p01a1

PDB Entry: 6p01, 1.89 Å

PDB Description: apo structure of the e52d mutant of ant-4

PDB Compounds: (A:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d6p01a1:

Sequence; same for both SEQRES and ATOM records:

>d6p01a1 d.218.1.1 (A:2-125) automated matches {Bacillus sp. [TaxId: 1409]}
ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdidmmcvmstee
aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq
taks

Timeline for d6p01a1:

• d6p01a1 is new in SCOPe 2.07-stable
  
• d6p01a1 appears in the current release, SCOPe 2.08