SCOPe 2.07: Domain d6nlta2: 6nlt A:126-253

Lineage for d6nlta2 (6nlt A:126-253)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families)

5. Family a.24.16.1: Kanamycin nucleotidyltransferase (KNTase), C-terminal domain [81592] (2 proteins)
   N-terminal catalytic domain is followed by an all-alpha domain
   automatically mapped to Pfam PF07827

6. Protein automated matches [379001] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [379545] (2 PDB entries)

8. Domain d6nlta2: 6nlt A:126-253 [379570]
   Other proteins in same PDB: d6nlta1, d6nltb1
   automated match to d1kana1
   complexed with ca; mutant

Details for d6nlta2

PDB Entry: 6nlt, 1.9 Å

PDB Description: apo structure of the t130k mutant of ant-4

PDB Compounds: (A:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d6nlta2:

Sequence; same for both SEQRES and ATOM records:

>d6nlta2 a.24.16.1 (A:126-253) automated matches {Staphylococcus aureus [TaxId: 1280]}
veaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhhricy
ttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterhgyiv
dvskripf

Timeline for d6nlta2:

• d6nlta2 is new in SCOPe 2.07-stable
  
• d6nlta2 appears in the current release, SCOPe 2.08