![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins) insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243 |
![]() | Protein automated matches [378998] (3 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [379543] (2 PDB entries) |
![]() | Domain d6nlta1: 6nlt A:1-125 [379569] Other proteins in same PDB: d6nlta2, d6nltb2 automated match to d1knya2 complexed with ca; mutant |
PDB Entry: 6nlt (more details), 1.9 Å
SCOPe Domain Sequences for d6nlta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nlta1 d.218.1.1 (A:1-125) automated matches {Staphylococcus aureus [TaxId: 1280]} mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste eaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvy qtaks
Timeline for d6nlta1: