Lineage for d6nlta1 (6nlt A:1-125)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2612758Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins)
    insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243
  6. 2612765Protein automated matches [378998] (3 species)
    not a true protein
  7. 2612786Species Staphylococcus aureus [TaxId:1280] [379543] (2 PDB entries)
  8. 2612789Domain d6nlta1: 6nlt A:1-125 [379569]
    Other proteins in same PDB: d6nlta2, d6nltb2
    automated match to d1knya2
    complexed with ca; mutant

Details for d6nlta1

PDB Entry: 6nlt (more details), 1.9 Å

PDB Description: apo structure of the t130k mutant of ant-4
PDB Compounds: (A:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d6nlta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nlta1 d.218.1.1 (A:1-125) automated matches {Staphylococcus aureus [TaxId: 1280]}
mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
eaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvy
qtaks

SCOPe Domain Coordinates for d6nlta1:

Click to download the PDB-style file with coordinates for d6nlta1.
(The format of our PDB-style files is described here.)

Timeline for d6nlta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6nlta2