SCOPe 2.08: Domain d6nlta1: 6nlt A:1-125

Lineage for d6nlta1 (6nlt A:1-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins)
   insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243

6. Protein automated matches [378998] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [379543] (2 PDB entries)

8. Domain d6nlta1: 6nlt A:1-125 [379569]
   Other proteins in same PDB: d6nlta2, d6nltb2
   automated match to d1knya2
   complexed with ca; mutant

Details for d6nlta1

PDB Entry: 6nlt, 1.9 Å

PDB Description: apo structure of the t130k mutant of ant-4

PDB Compounds: (A:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d6nlta1:

Sequence; same for both SEQRES and ATOM records:

>d6nlta1 d.218.1.1 (A:1-125) automated matches {Staphylococcus aureus [TaxId: 1280]}
mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
eaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvy
qtaks

Timeline for d6nlta1:

• d6nlta1 first appeared in SCOPe 2.07