Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) |
Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins) insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243 |
Protein automated matches [378998] (3 species) not a true protein |
Species Bacillus sp. [TaxId:1409] [379550] (4 PDB entries) |
Domain d6p08d1: 6p08 D:2-125 [379551] Other proteins in same PDB: d6p08a2, d6p08d2 automated match to d1knya2 protein/DNA complex; complexed with amp, mg, nmy, ppv; mutant |
PDB Entry: 6p08 (more details), 2.27 Å
SCOPe Domain Sequences for d6p08d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p08d1 d.218.1.1 (D:2-125) automated matches {Bacillus sp. [TaxId: 1409]} ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdidmmcvmstee aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq taks
Timeline for d6p08d1: