SCOPe 2.01: Domain d1b37b2: 1b37 B:294-405

Lineage for d1b37b2 (1b37 B:294-405)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Polyamine oxidase [54395] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [54396] (7 PDB entries)

8. Domain d1b37b2: 1b37 B:294-405 [37954]
   Other proteins in same PDB: d1b37a1, d1b37b1, d1b37c1
   complexed with fad, nag

Details for d1b37b2

PDB Entry: 1b37, 1.9 Å

PDB Description: a 30 angstrom u-shaped catalytic tunnel in the crystal structure of polyamine oxidase

PDB Compounds: (B:) protein (polyamine oxidase)

SCOPe Domain Sequences for d1b37b2:

Sequence; same for both SEQRES and ATOM records:

>d1b37b2 d.16.1.5 (B:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}
dmavytkiflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdee
srrieqqsdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsn

Timeline for d1b37b2:

• d1b37b2 first appeared (with stable ids) in SCOP 1.55
  
• d1b37b2 appears in SCOP 1.75
  
• d1b37b2 appears in SCOPe 2.02
  
• d1b37b2 appears in the current release, SCOPe 2.08