| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) ![]() |
| Family d.16.1.5: L-amino acid/polyamine oxidase [54394] (2 proteins) |
| Protein Polyamine oxidase [54395] (1 species) |
| Species Maize (Zea mays) [TaxId:4577] [54396] (7 PDB entries) |
| Domain d1b37b2: 1b37 B:294-405 [37954] Other proteins in same PDB: d1b37a1, d1b37b1, d1b37c1 |
PDB Entry: 1b37 (more details), 1.9 Å
SCOP Domain Sequences for d1b37b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b37b2 d.16.1.5 (B:294-405) Polyamine oxidase {Maize (Zea mays)}
dmavytkiflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdee
srrieqqsdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsn
Timeline for d1b37b2:
View in 3DDomains from other chains: (mouse over for more information) d1b37a1, d1b37a2, d1b37c1, d1b37c2 |