Lineage for d1b37b2 (1b37 B:294-405)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935459Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 2935624Protein Polyamine oxidase [54395] (1 species)
  7. 2935625Species Maize (Zea mays) [TaxId:4577] [54396] (7 PDB entries)
  8. 2935630Domain d1b37b2: 1b37 B:294-405 [37954]
    Other proteins in same PDB: d1b37a1, d1b37b1, d1b37c1
    complexed with fad

Details for d1b37b2

PDB Entry: 1b37 (more details), 1.9 Å

PDB Description: a 30 angstrom u-shaped catalytic tunnel in the crystal structure of polyamine oxidase
PDB Compounds: (B:) protein (polyamine oxidase)

SCOPe Domain Sequences for d1b37b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b37b2 d.16.1.5 (B:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}
dmavytkiflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdee
srrieqqsdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsn

SCOPe Domain Coordinates for d1b37b2:

Click to download the PDB-style file with coordinates for d1b37b2.
(The format of our PDB-style files is described here.)

Timeline for d1b37b2: