Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (31 species) not a true protein |
Species Roseiflexus castenholzii [TaxId:383372] [379492] (2 PDB entries) |
Domain d6l9sa_: 6l9s A: [379528] automated match to d1rkra_ complexed with cu1 |
PDB Entry: 6l9s (more details), 2 Å
SCOPe Domain Sequences for d6l9sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l9sa_ b.6.1.0 (A:) automated matches {Roseiflexus castenholzii [TaxId: 383372]} gasttieiasdgenlaydkkeftvptgqtitvtfkntstaqqhnivivkggedvaakvde eainagppdflpadrtniiaatkmlgpggsetitftapapgtyvflctypahyaggmkgv mtvap
Timeline for d6l9sa_: