Lineage for d1gpeb2 (1gpe B:329-524)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196365Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1196366Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1196367Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 1196394Protein Glucose oxidase [54391] (2 species)
  7. 1196398Species Penicillium amagasakiense [TaxId:63559] [54393] (1 PDB entry)
  8. 1196400Domain d1gpeb2: 1gpe B:329-524 [37952]
    Other proteins in same PDB: d1gpea1, d1gpeb1
    complexed with fad, nag

Details for d1gpeb2

PDB Entry: 1gpe (more details), 1.8 Å

PDB Description: glucose oxidase from penicillium amagasakiense
PDB Compounds: (B:) protein (glucose oxidase)

SCOPe Domain Sequences for d1gpeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpeb2 d.16.1.1 (B:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]}
nmqdqttttvssrassagagqgqavffanftetfgdyapqardllntkldqwaeetvarg
gfhnvtalkvqyenyrnwlldedvafaelfmdtegkinfdlwdlipftrgsvhilssdpy
lwqfandpkfflnefdllgqaaasklardltsqgamkeyfagetlpgynlvqnatlsqws
dyvlqnfrpnwhavss

SCOPe Domain Coordinates for d1gpeb2:

Click to download the PDB-style file with coordinates for d1gpeb2.
(The format of our PDB-style files is described here.)

Timeline for d1gpeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gpeb1