![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins) |
![]() | Protein Glucose oxidase [54391] (2 species) |
![]() | Species Penicillium amagasakiense [TaxId:63559] [54393] (1 PDB entry) |
![]() | Domain d1gpeb2: 1gpe B:329-524 [37952] Other proteins in same PDB: d1gpea1, d1gpeb1 complexed with fad, nag |
PDB Entry: 1gpe (more details), 1.8 Å
SCOPe Domain Sequences for d1gpeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpeb2 d.16.1.1 (B:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} nmqdqttttvssrassagagqgqavffanftetfgdyapqardllntkldqwaeetvarg gfhnvtalkvqyenyrnwlldedvafaelfmdtegkinfdlwdlipftrgsvhilssdpy lwqfandpkfflnefdllgqaaasklardltsqgamkeyfagetlpgynlvqnatlsqws dyvlqnfrpnwhavss
Timeline for d1gpeb2: