Lineage for d6johc_ (6joh C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951673Species Aspergillus flavus [TaxId:332952] [370521] (2 PDB entries)
  8. 2951700Domain d6johc_: 6joh C: [379515]
    automated match to d4fkxa_

Details for d6johc_

PDB Entry: 6joh (more details), 2.4 Å

PDB Description: the crystal of nucleoside diphosphate kinase from aspergillus flavus
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d6johc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6johc_ d.58.6.0 (C:) automated matches {Aspergillus flavus [TaxId: 332952]}
deqtfiaikpdgvqrglvgpiisrfenrgfklaalklcspskehleqhyadlsskpffpg
lvsymlsgpivamvwegrevvktgrtilgatnplasapgtirgdfaidvgrnvchgsdsv
enakkeialwfkpeelqkykhsqfdwiye

SCOPe Domain Coordinates for d6johc_:

Click to download the PDB-style file with coordinates for d6johc_.
(The format of our PDB-style files is described here.)

Timeline for d6johc_: