Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Penaeus japonicus [TaxId:27405] [379454] (15 PDB entries) |
Domain d6kh3a_: 6kh3 A: [379514] automated match to d5wpna_ complexed with fe, ni |
PDB Entry: 6kh3 (more details), 2.3 Å
SCOPe Domain Sequences for d6kh3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kh3a_ a.25.1.0 (A:) automated matches {Penaeus japonicus [TaxId: 27405]} asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere haqtfmkyqnkrggrivlqqiaapsmqewgtglealqaaldlekqvnqsllelhstasgn ndphltklledeyleeqvdsikkigdmitklkragphhglgeymfdkeln
Timeline for d6kh3a_: