Lineage for d1gpea2 (1gpe A:329-524)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189842Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 189843Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
  5. 189951Family d.16.1.4: Glucose oxidase [54390] (1 protein)
  6. 189952Protein Glucose oxidase [54391] (2 species)
  7. 189956Species Penicillium amagasakiense [TaxId:63559] [54393] (1 PDB entry)
  8. 189957Domain d1gpea2: 1gpe A:329-524 [37951]
    Other proteins in same PDB: d1gpea1, d1gpeb1

Details for d1gpea2

PDB Entry: 1gpe (more details), 1.8 Å

PDB Description: glucose oxidase from penicillium amagasakiense

SCOP Domain Sequences for d1gpea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpea2 d.16.1.4 (A:329-524) Glucose oxidase {Penicillium amagasakiense}
nmqdqttttvssrassagagqgqavffanftetfgdyapqardllntkldqwaeetvarg
gfhnvtalkvqyenyrnwlldedvafaelfmdtegkinfdlwdlipftrgsvhilssdpy
lwqfandpkfflnefdllgqaaasklardltsqgamkeyfagetlpgynlvqnatlsqws
dyvlqnfrpnwhavss

SCOP Domain Coordinates for d1gpea2:

Click to download the PDB-style file with coordinates for d1gpea2.
(The format of our PDB-style files is described here.)

Timeline for d1gpea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gpea1