Lineage for d1gal_2 (1gal 325-520)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) 
Family d.16.1.4: Glucose oxidase [54390] (1 protein) Protein Glucose oxidase [54391] (2 species) 
Species Aspergillus niger [54392] (2 PDB entries) 
Domain d1gal_2: 1gal 325-520 [37950]
Other proteins in same PDB: d1gal_1
Details for d1gal_2
PDB Entry: 1gal (more details), 2.3 Å
PDB Description: crystal structure of glucose oxidase from aspergillus niger: refined at 2.3 angstroms resolution
SCOP Domain Sequences for d1gal_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gal_2 d.16.1.4 (325-520) Glucose oxidase {Aspergillus niger}
nlqdqttatvrsritsagagqgqaawfatfnetfgdysekahellntkleqwaeeavarg
gfhnttalliqyenyrdwivnhnvayselfldtagvasfdvwdllpftrgyvhildkdpy
lhhfaydpqyflneldllgqaaatqlarnisnsgamqtyfagetipgdnlaydadlsawt
eyipyhfrpnyhgvgt
SCOP Domain Coordinates for d1gal_2:
Click to download the PDB-style file with coordinates for d1gal_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gal_2:
- d1gal_2 first appeared (with stable ids) in SCOP 1.55
- d1gal_2 appears in SCOP 1.59
- d1gal_2 appears in SCOP 1.63
- d1gal_2 appears in the current release, SCOPe 2.08, called d1gala2
View in 3D
