Lineage for d1gal_2 (1gal 325-520)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30799Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 30800Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 30903Family d.16.1.4: Glucose oxidase [54390] (1 protein)
  6. 30904Protein Glucose oxidase [54391] (2 species)
  7. 30905Species Aspergillus niger [54392] (2 PDB entries)
  8. 30907Domain d1gal_2: 1gal 325-520 [37950]
    Other proteins in same PDB: d1gal_1

Details for d1gal_2

PDB Entry: 1gal (more details), 2.3 Å

PDB Description: crystal structure of glucose oxidase from aspergillus niger: refined at 2.3 angstroms resolution

SCOP Domain Sequences for d1gal_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gal_2 d.16.1.4 (325-520) Glucose oxidase {Aspergillus niger}
nlqdqttatvrsritsagagqgqaawfatfnetfgdysekahellntkleqwaeeavarg
gfhnttalliqyenyrdwivnhnvayselfldtagvasfdvwdllpftrgyvhildkdpy
lhhfaydpqyflneldllgqaaatqlarnisnsgamqtyfagetipgdnlaydadlsawt
eyipyhfrpnyhgvgt

SCOP Domain Coordinates for d1gal_2:

Click to download the PDB-style file with coordinates for d1gal_2.
(The format of our PDB-style files is described here.)

Timeline for d1gal_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gal_1