Lineage for d1cf3a2 (1cf3 A:325-520)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 854919Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 854920Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 854921Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 854948Protein Glucose oxidase [54391] (2 species)
  7. 854949Species Aspergillus niger [TaxId:5061] [54392] (2 PDB entries)
  8. 854950Domain d1cf3a2: 1cf3 A:325-520 [37949]
    Other proteins in same PDB: d1cf3a1
    complexed with fad, man, nag

Details for d1cf3a2

PDB Entry: 1cf3 (more details), 1.9 Å

PDB Description: glucose oxidase from apergillus niger
PDB Compounds: (A:) protein (glucose oxidase)

SCOP Domain Sequences for d1cf3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]}
nlqdqttatvrsritsagagqgqaawfatfnetfgdysekahellntkleqwaeeavarg
gfhnttalliqyenyrdwivnhnvayselfldtagvasfdvwdllpftrgyvhildkdpy
lhhfaydpqyflneldllgqaaatqlarnisnsgamqtyfagetipgdnlaydadlsawt
eyipyhfrpnyhgvgt

SCOP Domain Coordinates for d1cf3a2:

Click to download the PDB-style file with coordinates for d1cf3a2.
(The format of our PDB-style files is described here.)

Timeline for d1cf3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cf3a1