Lineage for d1cf3a2 (1cf3 A:325-520)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30799Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 30800Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 30903Family d.16.1.4: Glucose oxidase [54390] (1 protein)
  6. 30904Protein Glucose oxidase [54391] (2 species)
  7. 30905Species Aspergillus niger [54392] (2 PDB entries)
  8. 30906Domain d1cf3a2: 1cf3 A:325-520 [37949]
    Other proteins in same PDB: d1cf3a1

Details for d1cf3a2

PDB Entry: 1cf3 (more details), 1.9 Å

PDB Description: glucose oxidase from apergillus niger

SCOP Domain Sequences for d1cf3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf3a2 d.16.1.4 (A:325-520) Glucose oxidase {Aspergillus niger}
nlqdqttatvrsritsagagqgqaawfatfnetfgdysekahellntkleqwaeeavarg
gfhnttalliqyenyrdwivnhnvayselfldtagvasfdvwdllpftrgyvhildkdpy
lhhfaydpqyflneldllgqaaatqlarnisnsgamqtyfagetipgdnlaydadlsawt
eyipyhfrpnyhgvgt

SCOP Domain Coordinates for d1cf3a2:

Click to download the PDB-style file with coordinates for d1cf3a2.
(The format of our PDB-style files is described here.)

Timeline for d1cf3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cf3a1