Lineage for d1b3mb2 (1b3m B:218-321)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30799Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 30800Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 30852Family d.16.1.3: D-amino acid oxidase-like [54384] (2 proteins)
  6. 30889Protein Sarcosine oxidase [54388] (1 species)
  7. 30890Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (6 PDB entries)
  8. 30902Domain d1b3mb2: 1b3m B:218-321 [37948]
    Other proteins in same PDB: d1b3ma1, d1b3mb1

Details for d1b3mb2

PDB Entry: 1b3m (more details), 2 Å

PDB Description: monomeric sarcosine oxidase from bacillus sp. b-0618

SCOP Domain Sequences for d1b3mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3mb2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618}
qlpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

SCOP Domain Coordinates for d1b3mb2:

Click to download the PDB-style file with coordinates for d1b3mb2.
(The format of our PDB-style files is described here.)

Timeline for d1b3mb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b3mb1