Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) |
Family d.16.1.3: D-amino acid oxidase-like [54384] (2 proteins) |
Protein Sarcosine oxidase [54388] (1 species) |
Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (6 PDB entries) |
Domain d1b3mb2: 1b3m B:218-321 [37948] Other proteins in same PDB: d1b3ma1, d1b3mb1 |
PDB Entry: 1b3m (more details), 2 Å
SCOP Domain Sequences for d1b3mb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3mb2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618} qlpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp dtinrefgvypedesnlrafleeympgangelkrgavcmytktl
Timeline for d1b3mb2: