SCOPe 2.08: Domain d6jafa2: 6jaf A:263-511

Lineage for d6jafa2 (6jaf A:263-511)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:31285] [268052] (13 PDB entries)

8. Domain d6jafa2: 6jaf A:263-511 [379472]
   Other proteins in same PDB: d6jafa3, d6jafb3
   automated match to d3wxla2
   complexed with gol, pop

Details for d6jafa2

PDB Entry: 6jaf, 2.9 Å

PDB Description: crystal structure of trypanosoma brucei gambiense glycerol kinase complex with ppi (pyrophosphatase reaction)

PDB Compounds: (A:) glycerol kinase

SCOPe Domain Sequences for d6jafa2:

Sequence; same for both SEQRES and ATOM records:

>d6jafa2 c.55.1.0 (A:263-511) automated matches {Trypanosoma brucei [TaxId: 31285]}
mcfekgeakntygtgcfllmnvgeearfskhgllstvgfqvgrdgpcyyalegaiacaga
tvewmrrnmnlfshiteceklarsvpgtqgivfvpafsgllapywdpsargtivgmtlkt
trahviraalqaialqlndvvgsmkrdaglnlsslrvdgglskngllmeiqasllgvdil
vpsmhettalgaalcaglaagvwtsleevkavsrrenswktvspsgsamereamiaewre
alkrtkwak

Timeline for d6jafa2:

• d6jafa2 first appeared in SCOPe 2.07