Lineage for d6kl7a1 (6kl7 A:5-175)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375767Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)
  6. 2375803Protein automated matches [227018] (2 species)
    not a true protein
  7. 2375821Species Rattus norvegicus [TaxId:10116] [379466] (1 PDB entry)
  8. 2375822Domain d6kl7a1: 6kl7 A:5-175 [379467]
    Other proteins in same PDB: d6kl7a2, d6kl7b1, d6kl7b2
    automated match to d2wtrb1
    complexed with ba, edo; mutant

Details for d6kl7a1

PDB Entry: 6kl7 (more details), 2.79 Å

PDB Description: beta-arrestin 1 mutant s13d/t275d
PDB Compounds: (A:) beta-arrestin-1

SCOPe Domain Sequences for d6kl7a1:

Sequence, based on SEQRES records: (download)

>d6kl7a1 b.1.18.11 (A:5-175) automated matches {Rattus norvegicus [TaxId: 10116]}
gtrvfkkadpngkltvylgkrdfvdhidlvdpvdgvvlvdpeylkerrvyvtltcafryg
redldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlp
csvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap

Sequence, based on observed residues (ATOM records): (download)

>d6kl7a1 b.1.18.11 (A:5-175) automated matches {Rattus norvegicus [TaxId: 10116]}
gtrvfkkadpngkltvylgkrdfvdhidlvdpvdgvvlvdpeylkerrvyvtltcafryg
redldvlgltfrkdlfvanvqsfppapkpltrlqerlikklgehaypftfeippnlpcsv
tlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap

SCOPe Domain Coordinates for d6kl7a1:

Click to download the PDB-style file with coordinates for d6kl7a1.
(The format of our PDB-style files is described here.)

Timeline for d6kl7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6kl7a2