Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins) |
Protein automated matches [227018] (2 species) not a true protein |
Species Rattus norvegicus [TaxId:10116] [379466] (1 PDB entry) |
Domain d6kl7a1: 6kl7 A:5-175 [379467] Other proteins in same PDB: d6kl7a2, d6kl7b1, d6kl7b2 automated match to d2wtrb1 complexed with ba, edo; mutant |
PDB Entry: 6kl7 (more details), 2.79 Å
SCOPe Domain Sequences for d6kl7a1:
Sequence, based on SEQRES records: (download)
>d6kl7a1 b.1.18.11 (A:5-175) automated matches {Rattus norvegicus [TaxId: 10116]} gtrvfkkadpngkltvylgkrdfvdhidlvdpvdgvvlvdpeylkerrvyvtltcafryg redldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlp csvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap
>d6kl7a1 b.1.18.11 (A:5-175) automated matches {Rattus norvegicus [TaxId: 10116]} gtrvfkkadpngkltvylgkrdfvdhidlvdpvdgvvlvdpeylkerrvyvtltcafryg redldvlgltfrkdlfvanvqsfppapkpltrlqerlikklgehaypftfeippnlpcsv tlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap
Timeline for d6kl7a1: