Lineage for d6hw2b_ (6hw2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785079Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2785156Protein automated matches [191035] (3 species)
    not a true protein
  7. 2785157Species Human (Homo sapiens) [TaxId:9606] [188859] (14 PDB entries)
  8. 2785171Domain d6hw2b_: 6hw2 B: [379461]
    automated match to d2fmma_
    complexed with act, bme, ca, gol

Details for d6hw2b_

PDB Entry: 6hw2 (more details), 1.94 Å

PDB Description: the crystal structure of cav beta4c in complex with hp1gamma chromo shadow domains
PDB Compounds: (B:) Chromobox protein homolog 3

SCOPe Domain Sequences for d6hw2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hw2b_ b.34.13.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aadkprgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafye
erltwhscp

SCOPe Domain Coordinates for d6hw2b_:

Click to download the PDB-style file with coordinates for d6hw2b_.
(The format of our PDB-style files is described here.)

Timeline for d6hw2b_: