SCOP 1.71: Domain d1el9b2: 1el9 B:218-321

Lineage for d1el9b2 (1el9 B:218-321)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)

6. Protein Sarcosine oxidase [54388] (1 species)

7. Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (9 PDB entries)

8. Domain d1el9b2: 1el9 B:218-321 [37946]
   Other proteins in same PDB: d1el9a1, d1el9b1
   complexed with cl, fad, mtg, po4

Details for d1el9b2

PDB Entry: 1el9, 2 Å

PDB Description: complex of monomeric sarcosine oxidase with the inhibitor [methylthio]acetate

SCOP Domain Sequences for d1el9b2:

Sequence; same for both SEQRES and ATOM records:

>d1el9b2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

Timeline for d1el9b2:

• d1el9b2 first appeared (with stable ids) in SCOP 1.55
  
• d1el9b2 appears in SCOP 1.69
  
• d1el9b2 appears in SCOP 1.73
  
• d1el9b2 appears in the current release, SCOPe 2.08