Lineage for d6jbpb_ (6jbp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792578Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2792579Protein automated matches [190445] (12 species)
    not a true protein
  7. 2792653Species Mucuna pruriens [TaxId:157652] [313698] (2 PDB entries)
  8. 2792654Domain d6jbpb_: 6jbp B: [379446]
    automated match to d5dssb_

Details for d6jbpb_

PDB Entry: 6jbp (more details), 2.22 Å

PDB Description: structure of mp-4 from mucuna pruriens at 2.22 angstroms
PDB Compounds: (B:) Kunitz-type trypsin inhibitor-like 2 protein

SCOPe Domain Sequences for d6jbpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jbpb_ b.42.4.0 (B:) automated matches {Mucuna pruriens [TaxId: 157652]}
aepvidtdgnplhrggkyyimpsiwgppggglrlgktenlncpvtvlqdysevinglpve
fnirgilprtiftdtelnieftekpncaensrwslfeddkihkayvgigdsedhpdqeml
sgsfyikkhglrnntyklvfcrdgsstcsdigrydnnedgrrliltadlpyevvfvnas

SCOPe Domain Coordinates for d6jbpb_:

Click to download the PDB-style file with coordinates for d6jbpb_.
(The format of our PDB-style files is described here.)

Timeline for d6jbpb_: