![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.4: STI-like [50386] (3 families) ![]() |
![]() | Family b.42.4.0: automated matches [191368] (1 protein) not a true family |
![]() | Protein automated matches [190445] (12 species) not a true protein |
![]() | Species Mucuna pruriens [TaxId:157652] [313698] (2 PDB entries) |
![]() | Domain d6jbpb_: 6jbp B: [379446] automated match to d5dssb_ |
PDB Entry: 6jbp (more details), 2.22 Å
SCOPe Domain Sequences for d6jbpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jbpb_ b.42.4.0 (B:) automated matches {Mucuna pruriens [TaxId: 157652]} aepvidtdgnplhrggkyyimpsiwgppggglrlgktenlncpvtvlqdysevinglpve fnirgilprtiftdtelnieftekpncaensrwslfeddkihkayvgigdsedhpdqeml sgsfyikkhglrnntyklvfcrdgsstcsdigrydnnedgrrliltadlpyevvfvnas
Timeline for d6jbpb_: